![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein Dianthin 30 [103335] (1 species) |
![]() | Species Clove pink (Dianthus caryophyllus) [TaxId:3570] [103336] (4 PDB entries) Uniprot P24476 24-278 |
![]() | Domain d1lpca_: 1lpc A: [91097] complexed with cmp |
PDB Entry: 1lpc (more details), 1.7 Å
SCOPe Domain Sequences for d1lpca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lpca_ d.165.1.1 (A:) Dianthin 30 {Clove pink (Dianthus caryophyllus) [TaxId: 3570]} ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvevigapsttdkflrlnfqgpr gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak dlqmgllkylgrpk
Timeline for d1lpca_: