Lineage for d1lpca_ (1lpc A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939585Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1939586Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1939587Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1939644Protein Dianthin 30 [103335] (1 species)
  7. 1939645Species Clove pink (Dianthus caryophyllus) [TaxId:3570] [103336] (4 PDB entries)
    Uniprot P24476 24-278
  8. 1939649Domain d1lpca_: 1lpc A: [91097]
    complexed with cmp

Details for d1lpca_

PDB Entry: 1lpc (more details), 1.7 Å

PDB Description: high resolution structure of recombinant dianthin antiviral protein-potent anti-hiv agent (complex with cyclic amp)
PDB Compounds: (A:) Dianthin 30

SCOPe Domain Sequences for d1lpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpca_ d.165.1.1 (A:) Dianthin 30 {Clove pink (Dianthus caryophyllus) [TaxId: 3570]}
ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvevigapsttdkflrlnfqgpr
gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged
yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar
fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak
dlqmgllkylgrpk

SCOPe Domain Coordinates for d1lpca_:

Click to download the PDB-style file with coordinates for d1lpca_.
(The format of our PDB-style files is described here.)

Timeline for d1lpca_: