Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries) |
Domain d1lp9m2: 1lp9 M:118-245 [91096] Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e1, d1lp9f1, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l1, d1lp9m1 |
PDB Entry: 1lp9 (more details), 2 Å
SCOP Domain Sequences for d1lp9m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lp9m2 b.1.1.2 (M:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain} dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgra
Timeline for d1lp9m2: