Lineage for d1lp9l2 (1lp9 L:118-198)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762507Protein T-cell antigen receptor [49125] (7 species)
  7. 1762598Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)
  8. 1762600Domain d1lp9l2: 1lp9 L:118-198 [91094]
    Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e1, d1lp9f1, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l1, d1lp9m1

Details for d1lp9l2

PDB Entry: 1lp9 (more details), 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1
PDB Compounds: (L:) T-cell receptor alpha chain

SCOPe Domain Sequences for d1lp9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9l2 b.1.1.2 (L:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifket

SCOPe Domain Coordinates for d1lp9l2:

Click to download the PDB-style file with coordinates for d1lp9l2.
(The format of our PDB-style files is described here.)

Timeline for d1lp9l2: