Lineage for d1lp9l1 (1lp9 L:0-117)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653994Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 654042Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (17 PDB entries)
  8. 654048Domain d1lp9l1: 1lp9 L:0-117 [91093]
    Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e2, d1lp9f2, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l2, d1lp9m2

Details for d1lp9l1

PDB Entry: 1lp9 (more details), 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1
PDB Compounds: (L:) T-cell receptor alpha chain

SCOP Domain Sequences for d1lp9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9l1 b.1.1.1 (L:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
mdsvtqteglvtlteglpvmlnctyqstyspflfwyvqhlneapklllksftdnkrpehq
gfhatlhkssssfhlqkssaqlsdsalyycalflasssfsklvfgqgtslsvvpn

SCOP Domain Coordinates for d1lp9l1:

Click to download the PDB-style file with coordinates for d1lp9l1.
(The format of our PDB-style files is described here.)

Timeline for d1lp9l1: