SCOP 1.67: Domain d1lp9h2: 1lp9 H:1-181

Lineage for d1lp9h2 (1lp9 H:1-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (33 PDB entries)

8. Domain d1lp9h2: 1lp9 H:1-181 [91091]
   Other proteins in same PDB: d1lp9a1, d1lp9b_, d1lp9e1, d1lp9e2, d1lp9f1, d1lp9f2, d1lp9h1, d1lp9i_, d1lp9l1, d1lp9l2, d1lp9m1, d1lp9m2

Details for d1lp9h2

PDB Entry: 1lp9, 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1

SCOP Domain Sequences for d1lp9h2:

Sequence; same for both SEQRES and ATOM records:

>d1lp9h2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1lp9h2:

• d1lp9h2 is new in SCOP 1.67
  
• d1lp9h2 appears in SCOP 1.69
  
• d1lp9h2 appears in the current release, SCOPe 2.08