Lineage for d1lp9h1 (1lp9 H:182-275)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358144Species Human (Homo sapiens) [TaxId:9606] [88605] (201 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2358244Domain d1lp9h1: 1lp9 H:182-275 [91090]
    Other proteins in same PDB: d1lp9a2, d1lp9b1, d1lp9b2, d1lp9e1, d1lp9e2, d1lp9f1, d1lp9f2, d1lp9h2, d1lp9i1, d1lp9i2, d1lp9l1, d1lp9l2, d1lp9m1, d1lp9m2

Details for d1lp9h1

PDB Entry: 1lp9 (more details), 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1
PDB Compounds: (H:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1lp9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9h1 b.1.1.2 (H:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d1lp9h1:

Click to download the PDB-style file with coordinates for d1lp9h1.
(The format of our PDB-style files is described here.)

Timeline for d1lp9h1: