Lineage for d1lp9f1 (1lp9 F:1-117)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931624Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
  8. 931629Domain d1lp9f1: 1lp9 F:1-117 [91088]
    Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e2, d1lp9f2, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l2, d1lp9m2

Details for d1lp9f1

PDB Entry: 1lp9 (more details), 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1
PDB Compounds: (F:) T-cell receptor beta chain

SCOPe Domain Sequences for d1lp9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9f1 b.1.1.1 (F:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
eaavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdi
pdgykasrpsqenfslilelaslsqtavyfcassdwvsyeqyfgpgtrltvle

SCOPe Domain Coordinates for d1lp9f1:

Click to download the PDB-style file with coordinates for d1lp9f1.
(The format of our PDB-style files is described here.)

Timeline for d1lp9f1: