Lineage for d1lp9a2 (1lp9 A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544763Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 2544821Domain d1lp9a2: 1lp9 A:1-181 [91084]
    Other proteins in same PDB: d1lp9a1, d1lp9b1, d1lp9b2, d1lp9e1, d1lp9e2, d1lp9f1, d1lp9f2, d1lp9h1, d1lp9i1, d1lp9i2, d1lp9l1, d1lp9l2, d1lp9m1, d1lp9m2

Details for d1lp9a2

PDB Entry: 1lp9 (more details), 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1lp9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1lp9a2:

Click to download the PDB-style file with coordinates for d1lp9a2.
(The format of our PDB-style files is described here.)

Timeline for d1lp9a2: