Lineage for d1lp9a1 (1lp9 A:182-275)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1106700Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1106784Domain d1lp9a1: 1lp9 A:182-275 [91083]
    Other proteins in same PDB: d1lp9a2, d1lp9b_, d1lp9e1, d1lp9e2, d1lp9f1, d1lp9f2, d1lp9h2, d1lp9i_, d1lp9l1, d1lp9l2, d1lp9m1, d1lp9m2

Details for d1lp9a1

PDB Entry: 1lp9 (more details), 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1lp9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d1lp9a1:

Click to download the PDB-style file with coordinates for d1lp9a1.
(The format of our PDB-style files is described here.)

Timeline for d1lp9a1: