Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries) |
Domain d1lp9a1: 1lp9 A:182-275 [91083] Other proteins in same PDB: d1lp9a2, d1lp9b_, d1lp9e1, d1lp9e2, d1lp9f1, d1lp9f2, d1lp9h2, d1lp9i_, d1lp9l1, d1lp9l2, d1lp9m1, d1lp9m2 |
PDB Entry: 1lp9 (more details), 2 Å
SCOP Domain Sequences for d1lp9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lp9a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1lp9a1: