Lineage for d1lp8a_ (1lp8 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681140Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1681141Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1681142Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1681197Protein Dianthin 30 [103335] (1 species)
  7. 1681198Species Clove pink (Dianthus caryophyllus) [TaxId:3570] [103336] (4 PDB entries)
    Uniprot P24476 24-278
  8. 1681200Domain d1lp8a_: 1lp8 A: [91082]

Details for d1lp8a_

PDB Entry: 1lp8 (more details), 1.65 Å

PDB Description: high resolution structure of recombinant dianthin antiviral protein-potent anti-hiv agent
PDB Compounds: (A:) Dianthin 30

SCOPe Domain Sequences for d1lp8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp8a_ d.165.1.1 (A:) Dianthin 30 {Clove pink (Dianthus caryophyllus) [TaxId: 3570]}
ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvevigapsttdkflrlnfqgpr
gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged
yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar
fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak
dlqmgllkylgrpk

SCOPe Domain Coordinates for d1lp8a_:

Click to download the PDB-style file with coordinates for d1lp8a_.
(The format of our PDB-style files is described here.)

Timeline for d1lp8a_: