Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1lmra_ (1lmr A:)

  1. Root: SCOP 1.75B
  2. Class g: Small proteins [56992] (90 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. Family g.3.6.3: Insect toxins [69930] (2 protein domains)
  6. Protein ADO1 [103535] (1 species)
  7. Species Assassin bug (Agriosphodrus dohrni) [TaxId:184613] [103536] (1 PDB entry)
  8. Domain d1lmra_: 1lmr A: [91081]

Details for d1lmra_

PDB Entry: 1lmr (more details)
PDB Description: solution of ado1, a toxin from the assassin bugs agriosphodrus dohrni that blocks the voltage sensitive calcium channel l-type
PDB Compounds: (A:) toxin ado1

SCOP Domain Sequences for d1lmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmra_ g.3.6.3 (A:) ADO1 {Assassin bug (Agriosphodrus dohrni) [TaxId: 184613]}
adddclprgskclgenkqcckgttcmfyanrcvgv

SCOP Domain Coordinates for d1lmra_:

Click to download the PDB-style file with coordinates for d1lmra_.
(The format of our PDB-style files is described here.)

Timeline for d1lmra_:

d1lmra_ appears in SCOP 1.75A


d1lmra_
(click for larger image)

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu