Lineage for d1lluh1 (1llu H:2-143,H:310-342)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2055849Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2055850Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2055978Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2055999Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2056178Species Pseudomonas aeruginosa [TaxId:287] [101702] (1 PDB entry)
  8. 2056186Domain d1lluh1: 1llu H:2-143,H:310-342 [91078]
    Other proteins in same PDB: d1llua2, d1llub2, d1lluc2, d1llud2, d1llue2, d1lluf2, d1llug2, d1lluh2
    complexed with edo, nad, zn

Details for d1lluh1

PDB Entry: 1llu (more details), 2.3 Å

PDB Description: the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate
PDB Compounds: (H:) alcohol dehydrogenase

SCOPe Domain Sequences for d1lluh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lluh1 b.35.1.2 (H:2-143,H:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
vnggyaeyvladpnyvgilpknXvkatihpgklddinqildqmragqiegrivlem

SCOPe Domain Coordinates for d1lluh1:

Click to download the PDB-style file with coordinates for d1lluh1.
(The format of our PDB-style files is described here.)

Timeline for d1lluh1: