Lineage for d1llug2 (1llu G:144-309)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387038Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (12 proteins)
    N-terminal all-beta domain defines family
  6. 387056Protein Alcohol dehydrogenase [51737] (9 species)
  7. 387207Species Pseudomonas aeruginosa [TaxId:287] [102122] (1 PDB entry)
  8. 387214Domain d1llug2: 1llu G:144-309 [91077]
    Other proteins in same PDB: d1llua1, d1llub1, d1lluc1, d1llud1, d1llue1, d1lluf1, d1llug1, d1lluh1

Details for d1llug2

PDB Entry: 1llu (more details), 2.3 Å

PDB Description: the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate

SCOP Domain Sequences for d1llug2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llug2 c.2.1.1 (G:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa}
vefaeiapilcagvtvykglkqtnarpgqwvaisgigglghvavqyaramglhvaaidid
daklelarklgasltvnarqedpveaiqrdiggahgvlvtavsnsafgqaigmarrggti
alvglppgdfptpifdvvlkglhiagsivgtradlqealdfagegl

SCOP Domain Coordinates for d1llug2:

Click to download the PDB-style file with coordinates for d1llug2.
(The format of our PDB-style files is described here.)

Timeline for d1llug2: