SCOPe 2.08: Domain d1llue2: 1llu E:144-309

Lineage for d1llue2 (1llu E:144-309)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [102122] (1 PDB entry)

8. Domain d1llue2: 1llu E:144-309 [91073]
   Other proteins in same PDB: d1llua1, d1llub1, d1lluc1, d1llud1, d1llue1, d1lluf1, d1llug1, d1lluh1
   complexed with edo, nad, zn

Details for d1llue2

PDB Entry: 1llu, 2.3 Å

PDB Description: the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate

PDB Compounds: (E:) alcohol dehydrogenase

SCOPe Domain Sequences for d1llue2:

Sequence; same for both SEQRES and ATOM records:

>d1llue2 c.2.1.1 (E:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
vefaeiapilcagvtvykglkqtnarpgqwvaisgigglghvavqyaramglhvaaidid
daklelarklgasltvnarqedpveaiqrdiggahgvlvtavsnsafgqaigmarrggti
alvglppgdfptpifdvvlkglhiagsivgtradlqealdfagegl

Timeline for d1llue2:

• d1llue2 first appeared in SCOP 1.67
  
• d1llue2 appears in SCOPe 2.07