![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
![]() | Protein Major tree pollen allergen [55963] (4 species) |
![]() | Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (5 PDB entries) |
![]() | Domain d1llta_: 1llt A: [91063] mutant |
PDB Entry: 1llt (more details), 3.1 Å
SCOPe Domain Sequences for d1llta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llta_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]} gvfnyetettsvipaarlfkafildgdnlfpkvapqaissvenisgnggpgtikkisfpe glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky htkgdhevkaeqvkaskemgetllravesyllahsdayn
Timeline for d1llta_: