Lineage for d1l7ba_ (1l7b A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113755Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113756Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 2113769Family c.15.1.2: DNA ligase [52117] (3 proteins)
  6. 2113774Protein NAD+-dependent DNA ligase, domain 4 [52118] (1 species)
  7. 2113775Species Thermus thermophilus [TaxId:274] [100975] (1 PDB entry)
  8. 2113776Domain d1l7ba_: 1l7b A: [91053]
    structural genomics; NESG target WR64TT; BRCT domain only

Details for d1l7ba_

PDB Entry: 1l7b (more details)

PDB Description: solution nmr structure of brct domain of t. thermophilus: northeast structural genomics consortium target wr64tt
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d1l7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]}
mekggealkgltfvitgelsrpreevkallrrlgakvtdsvsrktsylvvgenpgsklek
aralgvptlteeelyrlleartgkkaeelvgs

SCOPe Domain Coordinates for d1l7ba_:

Click to download the PDB-style file with coordinates for d1l7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1l7ba_: