Lineage for d1l2gc_ (1l2g C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362744Protein HSV glycoprotein D [63637] (1 species)
  7. 362745Species Herpes simplex virus type 1 [TaxId:10298] [63638] (2 PDB entries)
    elaborated with insertions and N- and C-terminal extensions
  8. 362749Domain d1l2gc_: 1l2g C: [91050]

Details for d1l2gc_

PDB Entry: 1l2g (more details), 2.85 Å

PDB Description: structure of a c-terminally truncated form of glycoprotein d from hsv- 1

SCOP Domain Sequences for d1l2gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2gc_ b.1.1.1 (C:) HSV glycoprotein D {Herpes simplex virus type 1}
pnrfrgkdlpvldqltdppgvrrvyhiqaglpdpfqppslpitvyyavleracrsvllna
pseapqivrgasedvrkqpynltiawfrmggncaipitvmeytecsynkslgacpirtqp
rwnyydsfsavsednlgflmhapafetagtylrlvkindwteitqfilehrakgsckyal
plrippsaclspqayqqgvtvdsigmlprfipenqrtvavyslkiagwhgpkapytstll
pp

SCOP Domain Coordinates for d1l2gc_:

Click to download the PDB-style file with coordinates for d1l2gc_.
(The format of our PDB-style files is described here.)

Timeline for d1l2gc_: