Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
Protein HSV glycoprotein D [63637] (1 species) |
Species Herpes simplex virus type 1 [TaxId:10298] [63638] (2 PDB entries) elaborated with insertions and N- and C-terminal extensions |
Domain d1l2gc_: 1l2g C: [91050] |
PDB Entry: 1l2g (more details), 2.85 Å
SCOP Domain Sequences for d1l2gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2gc_ b.1.1.1 (C:) HSV glycoprotein D {Herpes simplex virus type 1} pnrfrgkdlpvldqltdppgvrrvyhiqaglpdpfqppslpitvyyavleracrsvllna pseapqivrgasedvrkqpynltiawfrmggncaipitvmeytecsynkslgacpirtqp rwnyydsfsavsednlgflmhapafetagtylrlvkindwteitqfilehrakgsckyal plrippsaclspqayqqgvtvdsigmlprfipenqrtvavyslkiagwhgpkapytstll pp
Timeline for d1l2gc_: