Lineage for d1l2fa4 (1l2f A:1-126)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238632Fold d.202: Transcription factor NusA, N-terminal domain [69704] (1 superfamily)
    alpha-beta(3)-alpha-beta-alpha; bifurcated coiled beta-sheet
  4. 2238633Superfamily d.202.1: Transcription factor NusA, N-terminal domain [69705] (1 family) (S)
    automatically mapped to Pfam PF08529
  5. 2238634Family d.202.1.1: Transcription factor NusA, N-terminal domain [69706] (1 protein)
  6. 2238635Protein Transcription factor NusA, N-terminal domain [69707] (2 species)
  7. 2238639Species Thermotoga maritima [TaxId:2336] [69708] (2 PDB entries)
  8. 2238641Domain d1l2fa4: 1l2f A:1-126 [91047]
    Other proteins in same PDB: d1l2fa1, d1l2fa2, d1l2fa3

Details for d1l2fa4

PDB Entry: 1l2f (more details), 2.5 Å

PDB Description: Crystal structure of NusA from Thermotoga maritima: a structure-based role of the N-terminal domain
PDB Compounds: (A:) n utilization substance protein a

SCOPe Domain Sequences for d1l2fa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2fa4 d.202.1.1 (A:1-126) Transcription factor NusA, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyq
llevveevedpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrire
lekekq

SCOPe Domain Coordinates for d1l2fa4:

Click to download the PDB-style file with coordinates for d1l2fa4.
(The format of our PDB-style files is described here.)

Timeline for d1l2fa4: