Lineage for d1l2fa3 (1l2f A:277-344)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904630Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1904679Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1904680Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 1904763Protein Transcription factor NusA, C-terminal domains [69701] (2 species)
    duplication: tandem repeat of two type II KH-domains
  7. 1904775Species Thermotoga maritima [TaxId:2336] [69702] (2 PDB entries)
  8. 1904779Domain d1l2fa3: 1l2f A:277-344 [91046]
    Other proteins in same PDB: d1l2fa1, d1l2fa4

Details for d1l2fa3

PDB Entry: 1l2f (more details), 2.5 Å

PDB Description: Crystal structure of NusA from Thermotoga maritima: a structure-based role of the N-terminal domain
PDB Compounds: (A:) n utilization substance protein a

SCOPe Domain Sequences for d1l2fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2fa3 d.52.3.1 (A:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]}
ddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwki
dikpimnl

SCOPe Domain Coordinates for d1l2fa3:

Click to download the PDB-style file with coordinates for d1l2fa3.
(The format of our PDB-style files is described here.)

Timeline for d1l2fa3: