Lineage for d1l2fa3 (1l2f A:277-344)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602714Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 602741Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 602742Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 602775Protein Transcription factor NusA, C-terminal domains [69701] (2 species)
    duplication: tandem repeat of two type II KH-domains
  7. 602781Species Thermotoga maritima [TaxId:243274] [69702] (2 PDB entries)
  8. 602785Domain d1l2fa3: 1l2f A:277-344 [91046]
    Other proteins in same PDB: d1l2fa1, d1l2fa4

Details for d1l2fa3

PDB Entry: 1l2f (more details), 2.5 Å

PDB Description: Crystal structure of NusA from Thermotoga maritima: a structure-based role of the N-terminal domain

SCOP Domain Sequences for d1l2fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2fa3 d.52.3.1 (A:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima}
ddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwki
dikpimnl

SCOP Domain Coordinates for d1l2fa3:

Click to download the PDB-style file with coordinates for d1l2fa3.
(The format of our PDB-style files is described here.)

Timeline for d1l2fa3: