Lineage for d1l2fa1 (1l2f A:127-198)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374797Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins)
    barrel, closed; n=5, S=8
  6. 374930Protein S1 domain of NusA [69265] (2 species)
  7. 374934Species Thermotoga maritima [TaxId:243274] [69266] (2 PDB entries)
  8. 374936Domain d1l2fa1: 1l2f A:127-198 [91044]
    Other proteins in same PDB: d1l2fa2, d1l2fa3, d1l2fa4

Details for d1l2fa1

PDB Entry: 1l2f (more details), 2.5 Å

PDB Description: Crystal structure of NusA from Thermotoga maritima: a structure-based role of the N-terminal domain

SCOP Domain Sequences for d1l2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2fa1 b.40.4.5 (A:127-198) S1 domain of NusA {Thermotoga maritima}
fekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkvyiidvv
kttkgpkilvsr

SCOP Domain Coordinates for d1l2fa1:

Click to download the PDB-style file with coordinates for d1l2fa1.
(The format of our PDB-style files is described here.)

Timeline for d1l2fa1: