![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
![]() | Protein Tx10 alpha-like toxin [103540] (1 species) |
![]() | Species Chinese scorpion (Buthus martensii) [TaxId:34649] [103541] (1 PDB entry) |
![]() | Domain d1kv0b_: 1kv0 B: [91041] |
PDB Entry: 1kv0 (more details), 1.4 Å
SCOPe Domain Sequences for d1kv0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kv0b_ g.3.7.1 (B:) Tx10 alpha-like toxin {Chinese scorpion (Buthus martensii) [TaxId: 34649]} vrdgyialphncaygclnneycnnlctkdgakigycnivgkygnacwciqlpdnvpirvp grchpa
Timeline for d1kv0b_: