Lineage for d1kv0a_ (1kv0 A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427586Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 427587Family g.3.7.1: Long-chain scorpion toxins [57096] (4 proteins)
  6. 427643Protein Tx10 alpha-like toxin [103540] (1 species)
  7. 427644Species Chinese scorpion (Buthus martensii) [TaxId:34649] [103541] (1 PDB entry)
  8. 427645Domain d1kv0a_: 1kv0 A: [91040]

Details for d1kv0a_

PDB Entry: 1kv0 (more details), 1.4 Å

PDB Description: Cis/trans Isomerization of Non-prolyl Peptide Bond Observed in Crystal Structure of an Scorpion Toxin

SCOP Domain Sequences for d1kv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv0a_ g.3.7.1 (A:) Tx10 alpha-like toxin {Chinese scorpion (Buthus martensii)}
vrdgyialphncaygclnneycnnlctkdgakigycnivgkygnacwciqlpdnvpirvp
grchpa

SCOP Domain Coordinates for d1kv0a_:

Click to download the PDB-style file with coordinates for d1kv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1kv0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kv0b_