Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
Protein Tx10 alpha-like toxin [103540] (1 species) |
Species Chinese scorpion (Buthus martensii) [TaxId:34649] [103541] (1 PDB entry) |
Domain d1kv0a_: 1kv0 A: [91040] |
PDB Entry: 1kv0 (more details), 1.4 Å
SCOPe Domain Sequences for d1kv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kv0a_ g.3.7.1 (A:) Tx10 alpha-like toxin {Chinese scorpion (Buthus martensii) [TaxId: 34649]} vrdgyialphncaygclnneycnnlctkdgakigycnivgkygnacwciqlpdnvpirvp grchpa
Timeline for d1kv0a_: