![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein Fasciculin [57308] (1 species) different isoforms |
![]() | Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57309] (11 PDB entries) |
![]() | Domain d1ku6b_: 1ku6 B: [91038] Other proteins in same PDB: d1ku6a_ complexed with edo, nag |
PDB Entry: 1ku6 (more details), 2.5 Å
SCOPe Domain Sequences for d1ku6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ku6b_ g.7.1.1 (B:) Fasciculin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} tmcyshtttsrailtncgenscyrksrrhppkmvlgrgcgcppgddnlevkcctspdkcn y
Timeline for d1ku6b_: