Lineage for d1ku5a_ (1ku5 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353288Family a.22.1.2: Archaeal histone [47129] (1 protein)
  6. 353289Protein Archaeal histone [68897] (4 species)
  7. 353290Species Archaeon (Pyrococcus horikoshii) [TaxId:53953] [101106] (1 PDB entry)
  8. 353291Domain d1ku5a_: 1ku5 A: [91035]

Details for d1ku5a_

PDB Entry: 1ku5 (more details), 2.3 Å

PDB Description: Crystal Structure of recombinant histone HPhA from hyperthermophilic archaeon Pyrococcus horikoshii OT3

SCOP Domain Sequences for d1ku5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii)}
gelpiapvdrlirkagaervseqaakvlaeyleeyaieiakkavefarhagrktvkvedi
klaiks

SCOP Domain Coordinates for d1ku5a_:

Click to download the PDB-style file with coordinates for d1ku5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ku5a_:

353291
d1ku5a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ku5b_