Lineage for d1ktvb1 (1ktv B:283-399)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952119Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 952120Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 952159Protein Elongation factor G (EF-G), domain II [50456] (2 species)
  7. 952160Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)
  8. 952170Domain d1ktvb1: 1ktv B:283-399 [91031]
    Other proteins in same PDB: d1ktva2, d1ktva3, d1ktva4, d1ktvb2, d1ktvb3, d1ktvb4

Details for d1ktvb1

PDB Entry: 1ktv (more details), 3.8 Å

PDB Description: crystal structure of elongation factor g dimer without nucleotide
PDB Compounds: (B:) Elongation factor G

SCOPe Domain Sequences for d1ktvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktvb1 b.43.3.1 (B:283-399) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvil

SCOPe Domain Coordinates for d1ktvb1:

Click to download the PDB-style file with coordinates for d1ktvb1.
(The format of our PDB-style files is described here.)

Timeline for d1ktvb1: