Lineage for d1ktva3 (1ktv A:476-599)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499246Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 499247Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 499248Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 499255Protein Elongation factor G (EF-G), domain IV [54213] (1 species)
  7. 499256Species Thermus thermophilus [TaxId:274] [54214] (6 PDB entries)
  8. 499262Domain d1ktva3: 1ktv A:476-599 [91029]
    Other proteins in same PDB: d1ktva1, d1ktva2, d1ktva4, d1ktvb1, d1ktvb2, d1ktvb4

Details for d1ktva3

PDB Entry: 1ktv (more details), 3.8 Å

PDB Description: crystal structure of elongation factor g dimer without nucleotide

SCOP Domain Sequences for d1ktva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktva3 d.14.1.1 (A:476-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus}
vgkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvip
keyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavq
kgdp

SCOP Domain Coordinates for d1ktva3:

Click to download the PDB-style file with coordinates for d1ktva3.
(The format of our PDB-style files is described here.)

Timeline for d1ktva3: