SCOP 1.69: Domain d1ksqa_: 1ksq A:

Lineage for d1ksqa_ (1ksq A:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.23: TB module/8-cys domain [57580] (1 superfamily)
   disulfide-rich; alpha+beta

4. Superfamily g.23.1: TB module/8-cys domain [57581] (1 family)

5. Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins)
   transforming growth factor beta binding protein-like domain

6. Protein Transforming growth factor-beta binding protein-1 [103586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103587] (1 PDB entry)

8. Domain d1ksqa_: 1ksq A: [91026]
   third TB domain

Details for d1ksqa_

PDB Entry: 1ksq

PDB Description: nmr study of the third tb domain from latent transforming growth factor-beta binding protein-1

SCOP Domain Sequences for d1ksqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens)}
sadqpkeekkecyynlndaslcdnvlapnvtkqeccctsgagwgdnceifpcpvlgtaef
temcpkgkgfvpage

Timeline for d1ksqa_:

• d1ksqa_ first appeared in SCOP 1.67
  
• d1ksqa_ appears in SCOP 1.71
  
• d1ksqa_ appears in the current release, SCOPe 2.08, called d1ksqa1