SCOPe 2.08: Domain d1ksqa1: 1ksq A:3-75

Lineage for d1ksqa1 (1ksq A:3-75)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.23: TB module/8-cys domain [57580] (1 superfamily)
   disulfide-rich; alpha+beta

4. Superfamily g.23.1: TB module/8-cys domain [57581] (1 family)

5. Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins)
   transforming growth factor beta binding protein-like domain

6. Protein Transforming growth factor-beta binding protein-1 [103586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103587] (1 PDB entry)

8. Domain d1ksqa1: 1ksq A:3-75 [91026]
   Other proteins in same PDB: d1ksqa2
   third TB domain

Details for d1ksqa1

PDB Entry: 1ksq

PDB Description: nmr study of the third tb domain from latent transforming growth factor-beta binding protein-1

PDB Compounds: (A:) latent transforming growth factor beta binding protein 1

SCOPe Domain Sequences for d1ksqa1:

Sequence; same for both SEQRES and ATOM records:

>d1ksqa1 g.23.1.1 (A:3-75) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]}
dqpkeekkecyynlndaslcdnvlapnvtkqeccctsgagwgdnceifpcpvlgtaefte
mcpkgkgfvpage

Timeline for d1ksqa1:

• d1ksqa1 first appeared in SCOP 1.67, called d1ksqa_
  
• d1ksqa1 appears in SCOPe 2.07