Lineage for d1krwa_ (1krw A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 390874Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 390875Family c.23.1.1: CheY-related [52173] (16 proteins)
  6. 390966Protein NTRC receiver domain [52180] (1 species)
  7. 390967Species Salmonella typhimurium [TaxId:90371] [52181] (6 PDB entries)
  8. 390968Domain d1krwa_: 1krw A: [91024]

Details for d1krwa_

PDB Entry: 1krw (more details)

PDB Description: solution structure and backbone dynamics of beryllofluoride-activated ntrc receiver domain

SCOP Domain Sequences for d1krwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium}
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyq

SCOP Domain Coordinates for d1krwa_:

Click to download the PDB-style file with coordinates for d1krwa_.
(The format of our PDB-style files is described here.)

Timeline for d1krwa_: