Class a: All alpha proteins [46456] (258 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Phospholipase A2 [48637] (4 species) |
Species Human (Homo sapiens), synovial fluid [TaxId:9606] [48638] (12 PDB entries) |
Domain d1kqua_: 1kqu A: [91023] complexed with br4, ca |
PDB Entry: 1kqu (more details), 2.1 Å
SCOP Domain Sequences for d1kqua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqua_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} nlvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvthdccykrlekrgcg tkflsykfsnsgsritcakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs tprc
Timeline for d1kqua_: