Lineage for d1kq9a2 (1kq9 A:112-374,A:449-478)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418013Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 418014Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 418015Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 418038Protein Methionine aminopeptidase [55924] (5 species)
  7. 418057Species Human (Homo sapiens) [TaxId:9606] [55927] (7 PDB entries)
    methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold
  8. 418063Domain d1kq9a2: 1kq9 A:112-374,A:449-478 [91022]
    Other proteins in same PDB: d1kq9a1
    complexed with met, tbu, zn

Details for d1kq9a2

PDB Entry: 1kq9 (more details), 1.9 Å

PDB Description: Human methionine aminopeptidase type II in complex with L-methionine

SCOP Domain Sequences for d1kq9a2:

Sequence, based on SEQRES records: (download)

>d1kq9a2 d.127.1.1 (A:112-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens)}
qtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndfre
aaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnncaah
ytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikca
gidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikgge
atrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

Sequence, based on observed residues (ATOM records): (download)

>d1kq9a2 d.127.1.1 (A:112-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens)}
qtpsvpicdlypngvfpkgqeceypkkaldqaseeiwndfreaaeahrqvrkyvmswikp
gmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlqyddick
idfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgeaiqevme
syeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegevyaietfgst
gkgvvXdikgsytaqfehtillrptckevvsrgddy

SCOP Domain Coordinates for d1kq9a2:

Click to download the PDB-style file with coordinates for d1kq9a2.
(The format of our PDB-style files is described here.)

Timeline for d1kq9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kq9a1