Lineage for d1kq9a1 (1kq9 A:375-448)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438896Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. 438897Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 438906Species Human (Homo sapiens) [TaxId:9606] [46890] (7 PDB entries)
  8. 438912Domain d1kq9a1: 1kq9 A:375-448 [91021]
    Other proteins in same PDB: d1kq9a2

Details for d1kq9a1

PDB Entry: 1kq9 (more details), 1.9 Å

PDB Description: Human methionine aminopeptidase type II in complex with L-methionine

SCOP Domain Sequences for d1kq9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq9a1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens)}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

SCOP Domain Coordinates for d1kq9a1:

Click to download the PDB-style file with coordinates for d1kq9a1.
(The format of our PDB-style files is described here.)

Timeline for d1kq9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kq9a2