Lineage for d1kq6a_ (1kq6 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515590Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 515591Superfamily d.189.1: PX domain [64268] (1 family) (S)
  5. 515592Family d.189.1.1: PX domain [64269] (4 proteins)
  6. 515596Protein p47phox NADPH oxidase [64270] (1 species)
  7. 515597Species Human (Homo sapiens) [TaxId:9606] [64271] (3 PDB entries)
  8. 515598Domain d1kq6a_: 1kq6 A: [91020]

Details for d1kq6a_

PDB Entry: 1kq6 (more details), 1.18 Å

PDB Description: p47phox px domain

SCOP Domain Sequences for d1kq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq6a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens)}
gdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemfpie
againpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldffkvr
pddlklptdnqtkkpetylm

SCOP Domain Coordinates for d1kq6a_:

Click to download the PDB-style file with coordinates for d1kq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kq6a_: