![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
![]() | Protein Methionine aminopeptidase [55924] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55927] (7 PDB entries) methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold |
![]() | Domain d1kq0a2: 1kq0 A:111-374,A:449-478 [91019] Other proteins in same PDB: d1kq0a1 complexed with med, tbu, zn |
PDB Entry: 1kq0 (more details), 2 Å
SCOP Domain Sequences for d1kq0a2:
Sequence, based on SEQRES records: (download)
>d1kq0a2 d.127.1.1 (A:111-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens)} vqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndfr eaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnncaa hytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikc agidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikgg eatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy
>d1kq0a2 d.127.1.1 (A:111-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens)} vqtdppsvpicdlypngvfpkgqeceypeekkaldqaseeiwndfreaaeahrqvrkyvm swikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlqy ddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgeai qevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegevyaie tfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy
Timeline for d1kq0a2: