Lineage for d1koma_ (1kom A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516685Fold d.247: Chromosomal protein MC1 [102874] (1 superfamily)
    beta(2)-alpha-beta(3); 2 layers: alpha/beta
  4. 516686Superfamily d.247.1: Chromosomal protein MC1 [102875] (1 family) (S)
  5. 516687Family d.247.1.1: Chromosomal protein MC1 [102876] (1 protein)
  6. 516688Protein Chromosomal protein MC1 [102877] (1 species)
  7. 516689Species Archaeon Methanosarcina thermophila [TaxId:2210] [102878] (1 PDB entry)
  8. 516690Domain d1koma_: 1kom A: [90975]

Details for d1koma_

PDB Entry: 1kom (more details)

PDB Description: Solution NMR structure of the Archaebacterial Chromosomal Protein MC1

SCOP Domain Sequences for d1koma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koma_ d.247.1.1 (A:) Chromosomal protein MC1 {Archaeon Methanosarcina thermophila}
sntrnfvlrdedgnehgvftgkqprqaalkaanrgsgtkanpdiirlrergtkkvhvfka
wkeivdapknrpawmpekiskpfvkkeriekle

SCOP Domain Coordinates for d1koma_:

Click to download the PDB-style file with coordinates for d1koma_.
(The format of our PDB-style files is described here.)

Timeline for d1koma_: