Lineage for d1ko3a_ (1ko3 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736616Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 736617Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) (S)
  5. 736618Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 736619Protein Zn metallo-beta-lactamase [56283] (8 species)
  7. 736677Species Pseudomonas aeruginosa, VIM-2 [TaxId:287] [103316] (2 PDB entries)
  8. 736678Domain d1ko3a_: 1ko3 A: [90974]
    complexed with act, cl, oh, zn

Details for d1ko3a_

PDB Entry: 1ko3 (more details), 1.91 Å

PDB Description: VIM-2, a Zn-beta-lactamase from Pseudomonas aeruginosa with Cys221 reduced
PDB Compounds: (A:) VIM-2 metallo-beta-lactamase

SCOP Domain Sequences for d1ko3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn

SCOP Domain Coordinates for d1ko3a_:

Click to download the PDB-style file with coordinates for d1ko3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ko3a_: