Lineage for d1ko0a1 (1ko0 A:2-31,A:279-420)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320662Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1320793Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 1320821Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 1320822Protein Diaminopimelate decarboxylase LysA [89350] (3 species)
  7. 1320823Species Escherichia coli [TaxId:562] [101820] (2 PDB entries)
  8. 1320825Domain d1ko0a1: 1ko0 A:2-31,A:279-420 [90971]
    Other proteins in same PDB: d1ko0a2
    complexed with lys, plp

Details for d1ko0a1

PDB Entry: 1ko0 (more details), 2.2 Å

PDB Description: Crystal Structure of a D,L-lysine complex of diaminopimelate decarboxylase
PDB Compounds: (A:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1ko0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ko0a1 b.49.2.3 (A:2-31,A:279-420) Diaminopimelate decarboxylase LysA {Escherichia coli [TaxId: 562]}
phslfstdtdltaenllrlpaefgcpvwvyXvlitqvrsvkqmgsrhfvlvdagfndlmr
pamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetralpevkag
dylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalell

SCOPe Domain Coordinates for d1ko0a1:

Click to download the PDB-style file with coordinates for d1ko0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ko0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ko0a2