Lineage for d1knwa1 (1knw A:2-31,A:279-422)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377221Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 377302Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 377322Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 377323Protein Diaminopimelate decarboxylase LysA [89350] (2 species)
  7. 377324Species Escherichia coli [TaxId:562] [101820] (2 PDB entries)
  8. 377325Domain d1knwa1: 1knw A:2-31,A:279-422 [90969]
    Other proteins in same PDB: d1knwa2
    complexed with li, mes, plp, sul

Details for d1knwa1

PDB Entry: 1knw (more details), 2.1 Å

PDB Description: Crystal structure of diaminopimelate decarboxylase

SCOP Domain Sequences for d1knwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knwa1 b.49.2.3 (A:2-31,A:279-422) Diaminopimelate decarboxylase LysA {Escherichia coli}
phslfstdtdltaenllrlpaefgcpvwvyXvlitqvrsvkqmgsrhfvlvdagfndlmr
pamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetralpevkag
dylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalellhh

SCOP Domain Coordinates for d1knwa1:

Click to download the PDB-style file with coordinates for d1knwa1.
(The format of our PDB-style files is described here.)

Timeline for d1knwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1knwa2