Lineage for d1knwa1 (1knw A:2-31,A:279-420)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798988Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2799024Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 2799025Protein Diaminopimelate decarboxylase LysA [89350] (3 species)
  7. 2799026Species Escherichia coli [TaxId:562] [101820] (2 PDB entries)
  8. 2799027Domain d1knwa1: 1knw A:2-31,A:279-420 [90969]
    Other proteins in same PDB: d1knwa2, d1knwa3
    complexed with li, mes, plp, so4

Details for d1knwa1

PDB Entry: 1knw (more details), 2.1 Å

PDB Description: Crystal structure of diaminopimelate decarboxylase
PDB Compounds: (A:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1knwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knwa1 b.49.2.3 (A:2-31,A:279-420) Diaminopimelate decarboxylase LysA {Escherichia coli [TaxId: 562]}
phslfstdtdltaenllrlpaefgcpvwvyXvlitqvrsvkqmgsrhfvlvdagfndlmr
pamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetralpevkag
dylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalell

SCOPe Domain Coordinates for d1knwa1:

Click to download the PDB-style file with coordinates for d1knwa1.
(The format of our PDB-style files is described here.)

Timeline for d1knwa1: