Lineage for d1km8a_ (1km8 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1192691Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1192692Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1192693Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1192694Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 1192695Species Bullfrog (Rana catesbeiana) [TaxId:8400] [54085] (4 PDB entries)
  8. 1192696Domain d1km8a_: 1km8 A: [90967]
    complexed with po4

Details for d1km8a_

PDB Entry: 1km8 (more details), 1.9 Å

PDB Description: the structure of a cytotoxic ribonuclease from the oocyte of rana catesbeiana (bullfrog)
PDB Compounds: (A:) ribonuclease, oocytes

SCOPe Domain Sequences for d1km8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1km8a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp

SCOPe Domain Coordinates for d1km8a_:

Click to download the PDB-style file with coordinates for d1km8a_.
(The format of our PDB-style files is described here.)

Timeline for d1km8a_: