SCOPe 2.05: Domain d1km7a_: 1km7 A:

Lineage for d1km7a_ (1km7 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein GABA(A) receptor associated protein GABARAP [69658] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69659] (6 PDB entries)

8. Domain d1km7a_: 1km7 A: [90966]

Details for d1km7a_

PDB Entry: 1km7

PDB Description: solution structure and backbone dynamics of gabarap, gabaa receptor associated protein

PDB Compounds: (A:) GABA(A) Receptor associated protein

SCOPe Domain Sequences for d1km7a_:

Sequence; same for both SEQRES and ATOM records:

>d1km7a_ d.15.1.3 (A:) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]}
gekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqfyflirkrihlraedalf
ffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

Timeline for d1km7a_:

• d1km7a_ first appeared in SCOP 1.67
  
• d1km7a_ appears in SCOPe 2.04
  
• d1km7a_ appears in SCOPe 2.06
  
• d1km7a_ appears in the current release, SCOPe 2.08