Lineage for d1kcxb2 (1kcx B:67-400)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1341712Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
    automatically mapped to Pfam PF13147
  6. 1341742Protein Dihydropyrimidinase related protein-1 [102084] (1 species)
  7. 1341743Species Mouse (Mus musculus) [TaxId:10090] [102085] (1 PDB entry)
  8. 1341745Domain d1kcxb2: 1kcx B:67-400 [90956]
    Other proteins in same PDB: d1kcxa1, d1kcxb1
    structural genomics; NYSGR target T-45

Details for d1kcxb2

PDB Entry: 1kcx (more details), 2.12 Å

PDB Description: x-ray structure of nysgrc target t-45
PDB Compounds: (B:) dihydropyrimidinase related protein-1

SCOPe Domain Sequences for d1kcxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcxb2 c.1.9.6 (B:67-400) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]}
pggidvntylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwhea
adtksccdyslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaft
flkglgavilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagri
ncpvyitkvmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtspp
lspdpttpdyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvw
dkavatgkmdenqfvavtstnaakifnlyprkgr

SCOPe Domain Coordinates for d1kcxb2:

Click to download the PDB-style file with coordinates for d1kcxb2.
(The format of our PDB-style files is described here.)

Timeline for d1kcxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcxb1