Lineage for d1kcxb1 (1kcx B:15-66,B:401-490)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811542Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 811543Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 811595Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 811625Protein Dihydropyrimidinase related protein-1 [102017] (1 species)
  7. 811626Species Mouse (Mus musculus) [TaxId:10090] [102018] (1 PDB entry)
  8. 811628Domain d1kcxb1: 1kcx B:15-66,B:401-490 [90955]
    Other proteins in same PDB: d1kcxa2, d1kcxb2
    structural genomics; NYSGR target T-45

Details for d1kcxb1

PDB Entry: 1kcx (more details), 2.12 Å

PDB Description: x-ray structure of nysgrc target t-45
PDB Compounds: (B:) dihydropyrimidinase related protein-1

SCOP Domain Sequences for d1kcxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcxb1 b.92.1.3 (B:15-66,B:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]}
drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmviXiavgsda
dvviwdpdkmktitakshkstveynifegmechgsplvvisqgkivfedgnisvskgmgr
fiprkpfpehlyqrvrirskvfg

SCOP Domain Coordinates for d1kcxb1:

Click to download the PDB-style file with coordinates for d1kcxb1.
(The format of our PDB-style files is described here.)

Timeline for d1kcxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcxb2