SCOPe 2.08: Domain d1kcxb1: 1kcx B:15-66,B:401-490

Lineage for d1kcxb1 (1kcx B:15-66,B:401-490)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)

6. Protein Dihydropyrimidinase related protein-1 [102017] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [102018] (1 PDB entry)

8. Domain d1kcxb1: 1kcx B:15-66,B:401-490 [90955]
   Other proteins in same PDB: d1kcxa2, d1kcxb2
   structural genomics; NYSGR target T-45

Details for d1kcxb1

PDB Entry: 1kcx, 2.12 Å

PDB Description: x-ray structure of nysgrc target t-45

PDB Compounds: (B:) dihydropyrimidinase related protein-1

SCOPe Domain Sequences for d1kcxb1:

Sequence; same for both SEQRES and ATOM records:

>d1kcxb1 b.92.1.3 (B:15-66,B:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]}
drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmviXiavgsda
dvviwdpdkmktitakshkstveynifegmechgsplvvisqgkivfedgnisvskgmgr
fiprkpfpehlyqrvrirskvfg

Timeline for d1kcxb1:

• d1kcxb1 first appeared in SCOP 1.67
  
• d1kcxb1 appears in SCOPe 2.07