![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (8 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
![]() | Protein Dihydropyrimidinase related protein-1 [102017] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [102018] (1 PDB entry) |
![]() | Domain d1kcxa1: 1kcx A:15-66,A:401-490 [90953] Other proteins in same PDB: d1kcxa2, d1kcxb2 |
PDB Entry: 1kcx (more details), 2.12 Å
SCOP Domain Sequences for d1kcxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcxa1 b.92.1.3 (A:15-66,A:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmviXiavgsda dvviwdpdkmktitakshkstveynifegmechgsplvvisqgkivfedgnisvskgmgr fiprkpfpehlyqrvrirskvfg
Timeline for d1kcxa1: