Lineage for d1kcxa1 (1kcx A:15-66,A:401-490)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382243Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 382244Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 382290Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (3 proteins)
  6. 382317Protein Dihydropyrimidinase related protein-1 [102017] (1 species)
  7. 382318Species Mouse (Mus musculus) [TaxId:10090] [102018] (1 PDB entry)
  8. 382319Domain d1kcxa1: 1kcx A:15-66,A:401-490 [90953]
    Other proteins in same PDB: d1kcxa2, d1kcxb2

Details for d1kcxa1

PDB Entry: 1kcx (more details), 2.12 Å

PDB Description: x-ray structure of nysgrc target t-45

SCOP Domain Sequences for d1kcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcxa1 b.92.1.3 (A:15-66,A:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus)}
drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmviXiavgsda
dvviwdpdkmktitakshkstveynifegmechgsplvvisqgkivfedgnisvskgmgr
fiprkpfpehlyqrvrirskvfg

SCOP Domain Coordinates for d1kcxa1:

Click to download the PDB-style file with coordinates for d1kcxa1.
(The format of our PDB-style files is described here.)

Timeline for d1kcxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcxa2