SCOP 1.67: Domain d1kcxa1: 1kcx A:15-66,A:401-490

Lineage for d1kcxa1 (1kcx A:15-66,A:401-490)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (3 proteins)

6. Protein Dihydropyrimidinase related protein-1 [102017] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [102018] (1 PDB entry)

8. Domain d1kcxa1: 1kcx A:15-66,A:401-490 [90953]
   Other proteins in same PDB: d1kcxa2, d1kcxb2

Details for d1kcxa1

PDB Entry: 1kcx, 2.12 Å

PDB Description: x-ray structure of nysgrc target t-45

SCOP Domain Sequences for d1kcxa1:

Sequence; same for both SEQRES and ATOM records:

>d1kcxa1 b.92.1.3 (A:15-66,A:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus)}
drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmviXiavgsda
dvviwdpdkmktitakshkstveynifegmechgsplvvisqgkivfedgnisvskgmgr
fiprkpfpehlyqrvrirskvfg

Timeline for d1kcxa1:

• d1kcxa1 is new in SCOP 1.67
  
• d1kcxa1 appears in SCOP 1.69
  
• d1kcxa1 appears in the current release, SCOPe 2.08