Lineage for d1kcba2 (1kcb A:167-340)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1775028Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 1775029Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries)
  8. 1775039Domain d1kcba2: 1kcb A:167-340 [90952]
    complexed with cu; mutant

Details for d1kcba2

PDB Entry: 1kcb (more details), 1.65 Å

PDB Description: crystal structure of a no-forming nitrite reductase mutant: an analog of a transition state in enzymatic reaction
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1kcba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcba2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphlegghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d1kcba2:

Click to download the PDB-style file with coordinates for d1kcba2.
(The format of our PDB-style files is described here.)

Timeline for d1kcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcba1